Expression of the urease operon increases the likelihood of bacterial survival by contibuting to acid resistance in vitro and in vivo in BALB/c mice. Y.enterocolitica enters the body via an oral path and must survive the acidic stomach before being able to colonize the intestinal mucosa (PubMed:7558281). Urea amidohydrolase subunit gamma 100 MQLTPREVEKLMIYTLSDVAFKRKARGLKLNYPEAVSIITETAMEGARDGKSVEDVMKEASKVLTKDDVMDGVADLIPNVQVEAIFTDGSRLVTVHDPIK Urease subunit gamma yeuA URE3_YEREN ureA